Protein Info for BPHYT_RS32425 in Burkholderia phytofirmans PsJN

Annotation: formate dehydrogenase accessory protein FdhE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 TIGR01562: formate dehydrogenase accessory protein FdhE" amino acids 4 to 317 (314 residues), 265.6 bits, see alignment E=3.7e-83 PF04216: FdhE" amino acids 18 to 316 (299 residues), 342 bits, see alignment E=2.2e-106

Best Hits

KEGG orthology group: K02380, FdhE protein (inferred from 100% identity to bpy:Bphyt_6557)

Predicted SEED Role

"formate dehydrogenase formation protein FdhE" in subsystem Formate hydrogenase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TBB4 at UniProt or InterPro

Protein Sequence (331 amino acids)

>BPHYT_RS32425 formate dehydrogenase accessory protein FdhE (Burkholderia phytofirmans PsJN)
MVQRILEAGDIESLDHSAIPRLRMPERLAVFAARAARLRQLAALDNPIAGYLRLMAVLAD
AQQAVIAGFKAQPPSAELIASAQQHSMPLIPALSGVRDPAWRDVLRQLLDKVAVAGPLTP
PLEALIDRLRTLDTAALEFQADAIFAQRFEEIDPASAPFIVAALQVVWTDLAADIDKREV
PYLETLGLCPVCGSHPVASIVRVGGAYDNYRYLQCGLCSTEWHMVRTKCSNCDSTKGIAY
HTVGSPDADEAAREAESKNAALKAESCDECHTYRKIGTQSKDYDFEPFADDLASLTLDLL
MGAEGYRRASPHPWLWPEQGVGADESSGESD