Protein Info for BPHYT_RS32355 in Burkholderia phytofirmans PsJN

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 transmembrane" amino acids 14 to 38 (25 residues), see Phobius details amino acids 67 to 91 (25 residues), see Phobius details amino acids 106 to 129 (24 residues), see Phobius details amino acids 152 to 174 (23 residues), see Phobius details amino acids 209 to 234 (26 residues), see Phobius details amino acids 256 to 277 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 155 to 275 (121 residues), 35.5 bits, see alignment E=4.3e-13

Best Hits

Swiss-Prot: 30% identical to POTB_SHIFL: Spermidine/putrescine transport system permease protein PotB (potB) from Shigella flexneri

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_6541)

MetaCyc: 30% identical to spermidine preferential ABC transporter membrane subunit PotB (Escherichia coli K-12 substr. MG1655)
ABC-25-RXN [EC: 7.6.2.11, 7.6.2.16]; 7.6.2.11 [EC: 7.6.2.11, 7.6.2.16]

Predicted SEED Role

"ABC-type spermidine/putrescine transport system, permease component I"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.11 or 7.6.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TBA2 at UniProt or InterPro

Protein Sequence (290 amino acids)

>BPHYT_RS32355 ABC transporter permease (Burkholderia phytofirmans PsJN)
MATHDIERPGATPWLLSIPALLLFVGLLLVPLILTLMLSFRVFSDTEGIEAAYTLNNYLE
VVTDPYYGAIFLRTAGLAFAVTAASILLGVPETIILARMRRPWQSLALLVVLGPLLISVV
VRTLGWQILLGNNGVVNSILQALHITDRPVRLVFTMTGMVLALTHVLVPFMVMSVWTTMQ
RLDPQVEWAGRSLGGSPIKIFRRVIFPQILPGVLSGSIIVFALSASAFATPALIGGRRLK
VVATAAYDEFLGTLNWPLGASIAVLLLIANVAIVMGCSRLAEHRFKHIFH