Protein Info for BPHYT_RS32345 in Burkholderia phytofirmans PsJN

Annotation: LrgB family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 226 transmembrane" amino acids 28 to 49 (22 residues), see Phobius details amino acids 60 to 78 (19 residues), see Phobius details amino acids 86 to 111 (26 residues), see Phobius details amino acids 118 to 136 (19 residues), see Phobius details amino acids 147 to 168 (22 residues), see Phobius details amino acids 201 to 224 (24 residues), see Phobius details PF04172: LrgB" amino acids 11 to 223 (213 residues), 186.6 bits, see alignment E=2.1e-59

Best Hits

Swiss-Prot: 32% identical to YOHK_ECOLI: Inner membrane protein YohK (yohK) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_6539)

Predicted SEED Role

"CidA-associated membrane protein CidB" in subsystem Murein hydrolase regulation and cell death

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TBA0 at UniProt or InterPro

Protein Sequence (226 amino acids)

>BPHYT_RS32345 LrgB family protein (Burkholderia phytofirmans PsJN)
MITIVTLLSSTVAAYRLNTSIYKRWRGIWSSPLILTPLAIIAILPLAGVSYDTYVASTRP
LLWMIGPLTLALAVPVYQQRAFIRHWWPALVVGTIVSGTTAMISAIELAHFFDLPSTIAH
SLVARSVSLPFAFVVADEISGARDLTTLFVVVSGLVGIVVGDVLLVLMRLRSAQAHGATL
GAIAQVAGVARAHDRGTPNGVMASLTMVFSGAFAVLAAPFLVRFLQ