Protein Info for BPHYT_RS32340 in Burkholderia phytofirmans PsJN

Annotation: LrgA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 134 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 46 to 66 (21 residues), see Phobius details amino acids 73 to 94 (22 residues), see Phobius details amino acids 100 to 129 (30 residues), see Phobius details PF03788: LrgA" amino acids 41 to 121 (81 residues), 53.4 bits, see alignment E=1e-18

Best Hits

KEGG orthology group: K06518, holin-like protein (inferred from 100% identity to bpy:Bphyt_6538)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TB99 at UniProt or InterPro

Protein Sequence (134 amino acids)

>BPHYT_RS32340 LrgA family protein (Burkholderia phytofirmans PsJN)
MTQATSTINALLLPQWRGPLQALALVGSFMALSHVTASISPDMNPAITGFVLVLVGLASK
ALPLSIIEAGAKFLIAQSALFLIPAVVAVARQSALLQAHWIPLLVIVVGGTAISAAATAL
AVEFTTLALARRRS