Protein Info for BPHYT_RS32240 in Burkholderia phytofirmans PsJN

Annotation: chromosome replication initiation inhibitor protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 TIGR03298: transcriptional regulator, ArgP family" amino acids 3 to 292 (290 residues), 294.2 bits, see alignment E=4.4e-92 PF00126: HTH_1" amino acids 6 to 62 (57 residues), 66.1 bits, see alignment E=2.3e-22 PF03466: LysR_substrate" amino acids 120 to 288 (169 residues), 36.1 bits, see alignment E=4.6e-13

Best Hits

Swiss-Prot: 33% identical to ARGP_SODGM: HTH-type transcriptional regulator ArgP (argP) from Sodalis glossinidius (strain morsitans)

KEGG orthology group: K05596, LysR family transcriptional regulator, chromosome initiation inhibitor (inferred from 100% identity to bpy:Bphyt_6516)

Predicted SEED Role

"chromosome initiation inhibitor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TB80 at UniProt or InterPro

Protein Sequence (294 amino acids)

>BPHYT_RS32240 chromosome replication initiation inhibitor protein (Burkholderia phytofirmans PsJN)
MTFDRQQLETFCAVVELRNFGAAAKTLNVTRGAVSQRIIALEEALGAPLLVRDGNVPTPA
GEAVLRHAQALKLMEADTLQQIKPGTDGRAKIAIAVNADSLATWFEPVACAIAKDSCLLE
LIVDDQDFTLPVLTRGQAIGCVSTASRAPTGFVAEAIGAMAYECVATPSFCQTHFPHGLN
LHDILAAPAVLFNRKDGIHAGFIERLLGFPVGGYATHYFPSPVALLMAVRTGVGYGLVPT
MQAQPLIEAGGLVALAPRDRISIDLYWHHWEKAPPTARAISEMVMRHARQALGQ