Protein Info for BPHYT_RS32155 in Burkholderia phytofirmans PsJN

Annotation: type IV secretion system protein VirB11

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 TIGR02788: P-type DNA transfer ATPase VirB11" amino acids 36 to 339 (304 residues), 333 bits, see alignment E=7.7e-104 PF00437: T2SSE" amino acids 38 to 309 (272 residues), 127.2 bits, see alignment E=3.4e-41

Best Hits

KEGG orthology group: K03196, type IV secretion system protein VirB11 (inferred from 100% identity to bpy:Bphyt_6497)

Predicted SEED Role

"ATPase provides energy for both assembly of type IV secretion complex and secretion of T-DNA complex (VirB11)" in subsystem Type 4 secretion and conjugative transfer or pVir Plasmid of Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T8Z0 at UniProt or InterPro

Protein Sequence (372 amino acids)

>BPHYT_RS32155 type IV secretion system protein VirB11 (Burkholderia phytofirmans PsJN)
MIVRPDMQERSVDTVLARLPDDASVRELMRPFAPLLDDADVTELVINRPQRVLTETHLGW
HGHDYDDLDYERLMSFAVAVATLTNQEVSAQHPVLSALLPGDARIQIVVPPVVPPRTVSV
TIRRPSAREKSLDAYRDEGLFDDTLWHRPDGLDAALPTLRPTDRRLVRCLEERYWCAFFE
QAVTGRLNIVIVGNTGSGKTSFMKTLCRSIPSTERIVTIEDVRELFIRHIENCVHLLYSK
GGHGQARVTPADLIASTMRMRPDRVLLAELRGAEAYDFLKLLTTGHVGSITSYHASSATV
AIERFALMAKEHPEAAAYDDAALKRLLALTIDVVAHMEAYPLYDAAGEQIGKRWGMTEIW
FDPVRRARTTFS