Protein Info for BPHYT_RS32145 in Burkholderia phytofirmans PsJN

Annotation: type IV secretory pathway protein VirD4

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 583 PF02534: T4SS-DNA_transf" amino acids 15 to 448 (434 residues), 354.7 bits, see alignment E=1.3e-109 PF10412: TrwB_AAD_bind" amino acids 191 to 430 (240 residues), 55.7 bits, see alignment E=6.3e-19 PF12696: TraG-D_C" amino acids 295 to 415 (121 residues), 90 bits, see alignment E=1.8e-29

Best Hits

KEGG orthology group: K03205, type IV secretion system protein VirD4 (inferred from 100% identity to bpy:Bphyt_6495)

Predicted SEED Role

"Type IV secretion system protein VirD4" in subsystem Type 4 secretion and conjugative transfer or pVir Plasmid of Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T8Y8 at UniProt or InterPro

Protein Sequence (583 amino acids)

>BPHYT_RS32145 type IV secretory pathway protein VirD4 (Burkholderia phytofirmans PsJN)
MNAPALIDAPAIVVGIWRGRYLRFTGQQFVLLAAPARSGKGVSIVIPNLLSYPDSVVVLD
IKRENYAITAGFRLAHGQEVYLFDPFAEDGRTHRFNPLSSISDGLFRVGDILAIGYALYP
PNGHDDFWKDQARNLFLGIVLLLSEWRDARRTGRGESIPDYPVTMGEVLRQSSGHGMPVK
AYLQRALVQHRALLSGACVDALNRFLSNDDKVLASILATFHAPLTIWANPIVDAATSAND
FDLRDVRRRRMSVYIGITPDHLSEAALLVNLVFSQLVNLNTKQLPEADPTLRFQCLLLLD
EMTAIGKIHIIARAVAYMAGYNLRLLSVVQSIAQLESVYGRSDARTFLTNHAMQILYAPR
EQKDANDYSEMLGTFTDQSRSVSRPNTMFGGRGGSSESMSEQRRPLLLPQELKELGRDKE
IIVLENTKPILADRICYWRDPVFASRVSIAPSVPAMDLARFTAQIERRLREVESDEVESD
EIDPECAGLLHLSAEYLEVLQAWDPRDLPPRLADLSEDEVAAYVERHFMLLGVPARHIGQ
ATRRLSVADLDVAELVPPKSARERRGQGTRAGTNKASIKGARR