Protein Info for BPHYT_RS31935 in Burkholderia phytofirmans PsJN

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 31 to 52 (22 residues), see Phobius details amino acids 60 to 78 (19 residues), see Phobius details amino acids 84 to 105 (22 residues), see Phobius details amino acids 112 to 131 (20 residues), see Phobius details amino acids 151 to 171 (21 residues), see Phobius details amino acids 193 to 218 (26 residues), see Phobius details amino acids 224 to 243 (20 residues), see Phobius details amino acids 250 to 268 (19 residues), see Phobius details amino acids 274 to 293 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 31 to 287 (257 residues), 98 bits, see alignment E=2.7e-32

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 100% identity to bpy:Bphyt_6453)

Predicted SEED Role

"branched-chain amino acid transport system permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T8U7 at UniProt or InterPro

Protein Sequence (298 amino acids)

>BPHYT_RS31935 hypothetical protein (Burkholderia phytofirmans PsJN)
MFNINRSVVLWNVALFAAAIAWLAVSEPSYLTQLVVWSAINAVLAAGMRFVLLIGETNMA
SGAIYGFAAYVTAIAVTNGFDVVPLVVVTAAIAAGVLGLLFGWVTLRVKGPYFMLIGFAF
TEVVRLAYTRIDYVGGNSGMVGIYAPMSLDRWMPALCVGICYLLVSGFFVAEKSSFGLLM
RAIRNNDKVVETLGVSALRVKLVCFCIAALAVGAAGAIHAYSYHVISPGDFSFLIPVYAL
AYAKVGGERHIVGSVIGAIFLTVVAQVVQGAGALQYVLFGGVIILTMLGVRGGMLDML