Protein Info for BPHYT_RS31755 in Burkholderia phytofirmans PsJN

Annotation: amino acid ABC transporter ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 PF00005: ABC_tran" amino acids 20 to 165 (146 residues), 100 bits, see alignment E=1.9e-32 PF13304: AAA_21" amino acids 123 to 192 (70 residues), 27.6 bits, see alignment E=2.8e-10

Best Hits

Swiss-Prot: 48% identical to BRAG_PSEAE: High-affinity branched-chain amino acid transport ATP-binding protein BraG (braG) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_6415)

Predicted SEED Role

"Branched-chain amino acid transport ATP-binding protein LivF (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T8R6 at UniProt or InterPro

Protein Sequence (237 amino acids)

>BPHYT_RS31755 amino acid ABC transporter ATPase (Burkholderia phytofirmans PsJN)
MATILKIKGLQVNYGGIQAVKNVDMEVKTGDLVTLIGANGAGKTTTMKAIAGLKPYSVGD
IEYMGASIKGIPTHELLKRGLAMVPEGRGIFARMSIIENMQMGAYLRDDLHGVKRDIERM
FGFFPRLEERKLQFAGTLSGGEQQMLAMARAIISKPKLLLLDEPSMGLSPIMVEKIFEVV
REVSREGITVLLVEQNARLALQAASRGYVMESGTVTMSGDASKMLDDPKVRAAYLGE