Protein Info for BPHYT_RS31745 in Burkholderia phytofirmans PsJN

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 transmembrane" amino acids 22 to 45 (24 residues), see Phobius details amino acids 55 to 75 (21 residues), see Phobius details amino acids 80 to 100 (21 residues), see Phobius details amino acids 117 to 137 (21 residues), see Phobius details amino acids 145 to 162 (18 residues), see Phobius details amino acids 206 to 224 (19 residues), see Phobius details amino acids 257 to 280 (24 residues), see Phobius details amino acids 292 to 319 (28 residues), see Phobius details PF02653: BPD_transp_2" amino acids 51 to 339 (289 residues), 168.6 bits, see alignment E=8.1e-54

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_6413)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T8R4 at UniProt or InterPro

Protein Sequence (389 amino acids)

>BPHYT_RS31745 ABC transporter ATP-binding protein (Burkholderia phytofirmans PsJN)
MNTSPPIGHSSPLCPERSVKKYLTISALTAIGVTALPLLIGAAAGNYGVRVLDFAMLYVM
LALGLNIVVGFAGLLDLGYIAFYAVGAYTAALLTSPHLAAHFEWIGHMWPSGFHAPYWFV
MPVAMVLAAIAGICLGAPTLRLRGDYLAIVTLGFGEIVRIFMNNLDRPVNITNGPQGITG
VAPVTVAGFNLSETHAFLGFQFTTVYMYYYVFVLCSLLVVWVCTRLQHSRIGRAWAAIRE
DEIAAKAMGINTRNVKLLAFAMGASFGGLSGAMFAGFQGFVSPESFTLWESVTVLACVVL
GGMGHIPGVIFGAVLLAILPEILRSTMTPLQNAIFGHVIVDTEVIRQLLYGLAMVIIMLR
RPEGLWPAPKHEDRIARVAKKNHRRPVRA