Protein Info for BPHYT_RS31705 in Burkholderia phytofirmans PsJN

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 transmembrane" amino acids 35 to 56 (22 residues), see Phobius details amino acids 68 to 90 (23 residues), see Phobius details amino acids 102 to 120 (19 residues), see Phobius details amino acids 129 to 156 (28 residues), see Phobius details amino acids 176 to 195 (20 residues), see Phobius details amino acids 202 to 221 (20 residues), see Phobius details amino acids 249 to 272 (24 residues), see Phobius details amino acids 286 to 307 (22 residues), see Phobius details amino acids 316 to 335 (20 residues), see Phobius details amino acids 345 to 367 (23 residues), see Phobius details amino acids 377 to 398 (22 residues), see Phobius details amino acids 409 to 428 (20 residues), see Phobius details PF00083: Sugar_tr" amino acids 35 to 245 (211 residues), 87 bits, see alignment E=1.4e-28 amino acids 242 to 427 (186 residues), 39.5 bits, see alignment E=3.5e-14 PF07690: MFS_1" amino acids 35 to 274 (240 residues), 60.3 bits, see alignment E=1.6e-20 amino acids 259 to 427 (169 residues), 41.4 bits, see alignment E=9.3e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_6405)

Predicted SEED Role

"L-Proline/Glycine betaine transporter ProP" in subsystem Proline, 4-hydroxyproline uptake and utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T8Q6 at UniProt or InterPro

Protein Sequence (437 amino acids)

>BPHYT_RS31705 MFS transporter (Burkholderia phytofirmans PsJN)
MERKMNSNTYPDGISAPSVPGTAKAEQRRAAAAGMVGYILEWFDFGIYGFLAPIIAQNFF
PAHDSVTSLLVAFAVFGVGCVARPIGSVVLGRIADVKGRHGALATTMILMAASTVMMGLL
PTYSQIGIAAPILLVAARLLQGFAAGGEWGTAAAFLVEWGGSNRRGFLGAFQQSSIAAGL
MLASFVAAVLSTFIGHDGLAAWGWRIPFILGIVLGPIGFYVRRNVKESPMFIKAAQSTEK
ISNVLFWKSVLHGFCFLVLWFVSSYMVCVYMPSFAARYAHISETASLWAGSLSLAAVAVL
TPLAGLLSDRIGRKPLLLGSCLFFVIFSYPAYRLIVAGIGVGNYMLVQMLLTLAFILFSG
CGPAALAEMFPTKVRSLGVSIGGGVASILGGFTPFLTTWTISLTGSSASAGWLLAGSAAL
TLPVVIVMHDRSKQVEI