Protein Info for BPHYT_RS31540 in Burkholderia phytofirmans PsJN

Annotation: chloride channel protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 59 to 80 (22 residues), see Phobius details amino acids 105 to 128 (24 residues), see Phobius details amino acids 165 to 189 (25 residues), see Phobius details amino acids 201 to 222 (22 residues), see Phobius details amino acids 237 to 261 (25 residues), see Phobius details amino acids 281 to 302 (22 residues), see Phobius details amino acids 330 to 336 (7 residues), see Phobius details amino acids 342 to 362 (21 residues), see Phobius details amino acids 369 to 394 (26 residues), see Phobius details amino acids 399 to 421 (23 residues), see Phobius details PF00654: Voltage_CLC" amino acids 69 to 418 (350 residues), 276.1 bits, see alignment E=2.2e-86

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_6367)

Predicted SEED Role

"Chloride channel protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T8M4 at UniProt or InterPro

Protein Sequence (441 amino acids)

>BPHYT_RS31540 chloride channel protein (Burkholderia phytofirmans PsJN)
MRLRSLIDRQTLQRAHRLWLHYGVFWLGAVAVGLVAVAYARLIDFGYSEFLQYVARYRWL
PLLVTPAISAICVWLTLRFFPGSEGSGIPQVIATLHDRGGIGERLLTPGILLGKILVSFL
AMLGGFTIGREGPTIHVGAALMFNLRSFYPKRFRAMRGGALERRLALAGAAAGLSAAFNA
PLAGVVFAIEELTRSFEQRTSGVLITAIIFAGIVSLGIQGNYTYFGTIDIGTGFPDLLAV
AVVLIGVVAGSAGGIFCWLLLNTRRWMPSIILDCRSHRPILFGAGCGLVIAAIGVFSGGH
TFGSGYVEARDMLDGRAHLTILYPVLKMASMIGSYLPGAPGGLFAPSLAIGAGIGNALHL
VFSQMQLPMLIALGMVGYLAAVTQSPITSFVIVIEMINGHALVISLMATALIASQVSRLF
APPLYEALSERYSSGGAKQAS