Protein Info for BPHYT_RS31510 in Burkholderia phytofirmans PsJN

Annotation: sulfonate ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 transmembrane" amino acids 23 to 44 (22 residues), see Phobius details amino acids 50 to 69 (20 residues), see Phobius details amino acids 89 to 111 (23 residues), see Phobius details amino acids 128 to 147 (20 residues), see Phobius details amino acids 155 to 175 (21 residues), see Phobius details amino acids 187 to 208 (22 residues), see Phobius details amino acids 226 to 251 (26 residues), see Phobius details amino acids 263 to 284 (22 residues), see Phobius details amino acids 291 to 309 (19 residues), see Phobius details amino acids 315 to 336 (22 residues), see Phobius details amino acids 347 to 370 (24 residues), see Phobius details amino acids 391 to 415 (25 residues), see Phobius details amino acids 421 to 443 (23 residues), see Phobius details PF02133: Transp_cyt_pur" amino acids 9 to 432 (424 residues), 171.5 bits, see alignment E=1.5e-54

Best Hits

KEGG orthology group: K03457, nucleobase:cation symporter-1, NCS1 family (inferred from 100% identity to bpy:Bphyt_6361)

Predicted SEED Role

"Cytosine/purine/uracil/thiamine/allantoin permease family protein" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T8L9 at UniProt or InterPro

Protein Sequence (457 amino acids)

>BPHYT_RS31510 sulfonate ABC transporter substrate-binding protein (Burkholderia phytofirmans PsJN)
MIERRSIDYIPESERHGSVTSQFTLWLGANLQITAVVTGALAVVLGGDVFWSLIGLLIGQ
IVGGAVMALHGAQGPQLGLPQMISSRVQFGVYGAILPLLLVCIMYVGFSAGGMVLSGQAL
GHLLHIDNTSAILLFSGMVIVLATLGYRTIHVMGRLSSIVGVGAFLYLFASLLRGHDISA
LLQNCHFGMRTFLLAVSLSASWQIAYGPYVADYSRYLPRSTPAFKTFLAVGMGSVVGTQI
SMVFGVFAAALAGDRFAGHEVSFIVDLGASGAVAVILYVTIVLGKLTVTTLNAYGSVMSV
AAILTGFGGQRTISSYVRIFFIVLMVGLSTVLALSAGQHDFLRKFSAFLLFLLAFLTPWS
AINLVDYYFVVKERYDVPALFDPAGRYGRWNVKGIVVYVLGVGVQMPFIATSFYTGALVK
ALGGVDVSWIVGLIVPALLYSLVARNSQAPEALILPD