Protein Info for BPHYT_RS31300 in Burkholderia phytofirmans PsJN

Annotation: Crp/Fnr family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details PF00027: cNMP_binding" amino acids 70 to 154 (85 residues), 57 bits, see alignment E=2.4e-19 PF13545: HTH_Crp_2" amino acids 188 to 261 (74 residues), 73.6 bits, see alignment E=1.5e-24 PF00325: Crp" amino acids 213 to 244 (32 residues), 46.5 bits, see alignment 3.5e-16

Best Hits

Swiss-Prot: 42% identical to FNR_ECOL6: Fumarate and nitrate reduction regulatory protein (fnr) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K01420, CRP/FNR family transcriptional regulator, anaerobic regulatory protein (inferred from 87% identity to bug:BC1001_4988)

Predicted SEED Role

"cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases" in subsystem cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (262 amino acids)

>BPHYT_RS31300 Crp/Fnr family transcriptional regulator (Burkholderia phytofirmans PsJN)
MSDVAASPAIAPALARPKGSPLAGRVSASAGASRKGAASCTACSMRSICMPHGLTVEELQ
RIESLICPSRTIKQGETIYRANDSFQSIYAVRAGSFKTVVMHRDGREQVTGFHLAGDSLG
LDGVCSGYHSCDAVALEDSKVCIIPFHLLEAMCREVKAVQQHVHRMMGGEIVRESSQMML
LGTMSAEQRVATFLLNLSDRLRMRGYSPAEFHLRMTREEIGSYLGIKLETVSRMLSKFQR
DGLLDTHGKDIRILDHERLVRV