Protein Info for BPHYT_RS31290 in Burkholderia phytofirmans PsJN

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 51 to 70 (20 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 93 to 216 (124 residues), 71.9 bits, see alignment E=2.7e-24 PF00989: PAS" amino acids 96 to 209 (114 residues), 40.9 bits, see alignment E=4.7e-14 PF08448: PAS_4" amino acids 103 to 213 (111 residues), 41.8 bits, see alignment E=2.9e-14 PF13426: PAS_9" amino acids 106 to 211 (106 residues), 43.1 bits, see alignment E=1.1e-14 PF07730: HisKA_3" amino acids 240 to 306 (67 residues), 58.8 bits, see alignment E=1.5e-19 PF02518: HATPase_c" amino acids 349 to 439 (91 residues), 39.3 bits, see alignment E=1.9e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_6313)

Predicted SEED Role

"Signal transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TB44 at UniProt or InterPro

Protein Sequence (448 amino acids)

>BPHYT_RS31290 histidine kinase (Burkholderia phytofirmans PsJN)
MPVSGNPPPSRTAALRGLCGSFAAPPALAAATVFVVTLGVMLAARHWFDPVLFICAAAAL
LLATSAYVLVRTHRNDAHANGETNAGISQSALNEARMMAIIRSSMEAIITIDEQQRVVIF
NPMAERIFGCSAMDAIGAPLARFIPERFRAAHAQHVAQFGVTGVSDRQMGNQRVLAGLRA
NGEEFPLEASISQIRDGDTRLYTVMLRDITERVKAECAQRQAREELRELSANLQNIREDE
KTRIARELHDDLGQQLTALKMDISSVEQALDASAGAAVRDQLHGMRRLIDTTVASVRRIA
ADLRPVMLDDLGLIPAIEWLANDFTNRYGIDVERQIETGDARFSPAGATALFRIVQEALT
NVARHADATLVTLSLQAKEQAFELSIADNGQGAHRTAEPAAKSFGLLGVRERAHMLGGAV
DIHTAHGKGFVLTVTIPAETVQMQEIQT