Protein Info for BPHYT_RS31280 in Burkholderia phytofirmans PsJN

Annotation: iron transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 transmembrane" amino acids 49 to 70 (22 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 125 to 143 (19 residues), see Phobius details amino acids 151 to 173 (23 residues), see Phobius details amino acids 185 to 209 (25 residues), see Phobius details amino acids 251 to 273 (23 residues), see Phobius details amino acids 293 to 320 (28 residues), see Phobius details amino acids 341 to 360 (20 residues), see Phobius details amino acids 366 to 388 (23 residues), see Phobius details amino acids 401 to 423 (23 residues), see Phobius details PF01566: Nramp" amino acids 35 to 400 (366 residues), 270.2 bits, see alignment E=1.3e-84

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_6311)

Predicted SEED Role

"Manganese transport protein MntH" in subsystem Transport of Manganese

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TB42 at UniProt or InterPro

Protein Sequence (425 amino acids)

>BPHYT_RS31280 iron transporter (Burkholderia phytofirmans PsJN)
MKPRGSLLARLKEHPLARLGPGLITGVADDDPSGIATYSQAGAQFGLNMLWTMPLAFPLM
AAVQSMCANLGRVTGKGLAANIKDVFPPAVLYAVVLLLLVANTLNIAADVAAMGEVAQLV
IGIDRHVMTVCFVFATLLLQIFVPYHRYVFFLKWLTVSLLAYAAVLFVVHVPWSDVALRT
LWPHFALNANAAAMVVAVFGTTISPYLFFWQASEEVEDLHARTDSAPLVSDARFARAELQ
RIRWDTWSGMLYSDLTAYFIMLATAVTLHAAGVTDITTAAQAASALRPLAGDFAYLLFAL
GILGVGFIGVPVLAGSGAYALAEAMGWPEGLERKLRDARGFYGIIAVSVLAALAIQYSSI
SPMKALFWSAVINGVVAVPLMAVILLLVSKRAVMGDFTASRPLIVLGSIATVVMGSAAVM
MLLPA