Protein Info for BPHYT_RS31225 in Burkholderia phytofirmans PsJN

Annotation: D-alanyl-D-alanine dipeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01427: Peptidase_M15
  • amino acids 6 to 170 (165 residues), 147.9 bits, E=3.4e-47
• PF02557: VanY
  • amino acids 44 to 166 (123 residues), 25.1 bits, E=1.3e-09

Best Hits

Swiss-Prot: 52% identical to DDPX_ECOLI: D-alanyl-D-alanine dipeptidase (ddpX) from Escherichia coli (strain K12)

KEGG orthology group: K08641, D-alanyl-D-alanine dipeptidase [EC: 3.4.13.22] (inferred from 100% identity to bpy:Bphyt_6300)

MetaCyc: 52% identical to D-alanyl-D-alanine dipeptidase (Escherichia coli K-12 substr. MG1655)
D-Ala-D-Ala dipeptidase. [EC: 3.4.13.22]

Predicted SEED Role

"D-alanyl-D-alanine dipeptidase (EC 3.4.13.22)" (EC 3.4.13.22)

MetaCyc Pathways

• vancomycin resistance I (2/3 steps found)
• vancomycin resistance II (1/3 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.13.22

Sequence Analysis Tools

See B2TB31 at UniProt or InterPro

Protein Sequence (187 amino acids)

>BPHYT_RS31225 D-alanyl-D-alanine dipeptidase (Burkholderia phytofirmans PsJN)
MTEPRLIEITRAGHGVDIDLVYATERNLTGKPIYKEAHCLLLEPAEAALRKAVTIAREAG
LTLRIFDAYRPPQAQQVLWDFLPDPTYVAELGRGSNHSRGTAIDLTLLDANGNELDMGTG
FDAMTIESEHFHPGLPEHVQRNRLLLLGIMHAAGFAHIKNEWWHYELPGSRALPVIDNSE
SGPLRLM