Protein Info for BPHYT_RS31205 in Burkholderia phytofirmans PsJN

Annotation: peptide ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 PF00005: ABC_tran" amino acids 47 to 207 (161 residues), 98.8 bits, see alignment E=4.3e-32 TIGR01727: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain" amino acids 257 to 343 (87 residues), 96.9 bits, see alignment E=2.9e-32 PF08352: oligo_HPY" amino acids 259 to 323 (65 residues), 73.7 bits, see alignment E=1.3e-24

Best Hits

KEGG orthology group: K02032, peptide/nickel transport system ATP-binding protein (inferred from 100% identity to bpy:Bphyt_6296)

Predicted SEED Role

"Oligopeptide transport ATP-binding protein OppF (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TB27 at UniProt or InterPro

Protein Sequence (347 amino acids)

>BPHYT_RS31205 peptide ABC transporter ATP-binding protein (Burkholderia phytofirmans PsJN)
MNAPHVMAPLVEVDHVSRRFVRRLNYAERIAGWLGARAEEQIVHAVDDVSLTIHRGEVLG
LVGESGCGKSTLGRMLAGIGAPSSGSIRTLEKIAEQSAPGSEHDGTRAGKRTSRHRLATQ
MIFQDPLSSLNPRKRVRDIIGEAPLVHGIVERKQLDAYVVDVMERVGLNPDFRERFPHQF
SGGQRQRIGIGRALAVKPDFLICDESIAALDVSIQAQIINLFMQLRRDLGLTYLFISHDL
GVVEHISDRVAIMYLGRIVETAPTVELFANPQHPYTIALLAQVPRLSNRKRQFESIQGEI
PSPLAPPDGCHFHPRCPHATQRCRTERPLLRQSGAAHQVACHLVEVR