Protein Info for BPHYT_RS31195 in Burkholderia phytofirmans PsJN

Annotation: peptide ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 transmembrane" amino acids 30 to 52 (23 residues), see Phobius details amino acids 102 to 128 (27 residues), see Phobius details amino acids 140 to 160 (21 residues), see Phobius details amino acids 166 to 186 (21 residues), see Phobius details amino acids 213 to 234 (22 residues), see Phobius details amino acids 239 to 258 (20 residues), see Phobius details amino acids 266 to 289 (24 residues), see Phobius details PF12911: OppC_N" amino acids 21 to 71 (51 residues), 27.3 bits, see alignment 2.7e-10 PF00528: BPD_transp_1" amino acids 118 to 302 (185 residues), 105.3 bits, see alignment E=3.3e-34

Best Hits

Swiss-Prot: 37% identical to DPPC_HAEIN: Dipeptide transport system permease protein DppC (dppC) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 100% identity to bpy:Bphyt_6294)

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TB25 at UniProt or InterPro

Protein Sequence (303 amino acids)

>BPHYT_RS31195 peptide ABC transporter permease (Burkholderia phytofirmans PsJN)
MRHSATVFAWRPDRNTTSGIVLRSLFGKPAVAVATCVCLLLVAIALLAPWIAPQNPYDLA
ALNLVDGRLPPGARGVNGHLYLLGSDALGRDMFAAMMYGLRISLGVGLLSGVFAMSLGTT
LGLVAAYFGGRVDTLVMRAVDLMLGFPTILVALMMLAILGQGVDKVILALVVVQWAYFAR
TVRAVAAVERRKEYMEAAFCLGLSHRRALFSQLLPNCLPPVIVIALVQIAAAISAEATLS
FLGIGLPVTQPSLGLLIANGYQQLIAGFYWISVFPGLLLLVLVFSMNIVGDSLREALNPR
LQK