Protein Info for BPHYT_RS31190 in Burkholderia phytofirmans PsJN

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 98 to 121 (24 residues), see Phobius details amino acids 140 to 161 (22 residues), see Phobius details amino acids 185 to 203 (19 residues), see Phobius details amino acids 233 to 252 (20 residues), see Phobius details amino acids 257 to 278 (22 residues), see Phobius details amino acids 289 to 313 (25 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 1 to 101 (101 residues), 45.5 bits, see alignment E=7.7e-16 PF00528: BPD_transp_1" amino acids 112 to 319 (208 residues), 143.5 bits, see alignment E=6.6e-46

Best Hits

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 100% identity to bpy:Bphyt_6293)

Predicted SEED Role

"Dipeptide transport system permease protein DppB (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TB24 at UniProt or InterPro

Protein Sequence (323 amino acids)

>BPHYT_RS31190 ABC transporter permease (Burkholderia phytofirmans PsJN)
MIAFIIRRLIQSIGVLLLTSVLVFCGVFAIGDPIAILVPADATPAEIAQAVQSLGLDRPL
WQQYLHFIGRALHGDLGRSFVFNQPSIPLILERLPATLELACVALVLALIVGLPLGLIAG
LKAGSVLDRTVMTGSILGFSLPNFWQGIMLVLIFSVTLGWLPSAGRGQPGILFGIHTSLA
TWDGLRHLLLPALNLSLFKMSLVTRLTRAGVRETLPLDYVKFARAKGLRERRVIFVHVLK
NILIPIVTVVGMEFGSLIAFATVTETIFAWPGVGKLIIDSITKLDRPVIVAYLLIVVAMF
TLLNLLVDIIYSLLDPRVRLEAA