Protein Info for BPHYT_RS31140 in Burkholderia phytofirmans PsJN

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 transmembrane" amino acids 24 to 41 (18 residues), see Phobius details amino acids 61 to 79 (19 residues), see Phobius details amino acids 94 to 112 (19 residues), see Phobius details amino acids 119 to 140 (22 residues), see Phobius details amino acids 152 to 178 (27 residues), see Phobius details amino acids 185 to 207 (23 residues), see Phobius details amino acids 255 to 276 (22 residues), see Phobius details amino acids 296 to 314 (19 residues), see Phobius details amino acids 321 to 337 (17 residues), see Phobius details amino acids 343 to 365 (23 residues), see Phobius details amino acids 377 to 398 (22 residues), see Phobius details amino acids 410 to 428 (19 residues), see Phobius details PF07690: MFS_1" amino acids 34 to 395 (362 residues), 145.7 bits, see alignment E=8.5e-47

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_6283)

Predicted SEED Role

"D-galactarate permease" in subsystem D-galactarate, D-glucarate and D-glycerate catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TB14 at UniProt or InterPro

Protein Sequence (442 amino acids)

>BPHYT_RS31140 MFS transporter (Burkholderia phytofirmans PsJN)
MSRSIPATAGPDRTDALASAVRKIKWHVLPLFVVMFVVNYIDRVNIGFVRQHLSADLGIG
AAAYGLGAGLFFVSYAIFEVPSNMLLQRFGAKAWLTRIMFTWGLAAVGMAFVRGETSFYA
MRLLLGAAEAGFFPGVIFYFTQWLPRGERGKAMAIFLSGSALASILSGPISGALMLISGG
GLHGWQWMFVIEGMASVVLAGFIWFWLDSKPRDARWLSSAEQNAIVAEIEEEQRERDAAH
AVMPSVWTLLRDPQILIFCVIYFSVSLTIYGATFWLPSIIRKMGHFNDFQVGLFNSIPWL
ISIVAMYLFAMLAARFKFQQAWVACVLLIAALGMYAAGQGSPLFSFVAICFAAIGFKAAS
ALFWPIPQGYLDARISAAVLALINSIGNLGGFVAPAAFGLLEQKTGSIEGGLTGLAVMSV
VAAGVVFFSRMKPREGRSALAL