Protein Info for BPHYT_RS31120 in Burkholderia phytofirmans PsJN

Annotation: pseudouridine-5'-phosphate glycosidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04227: Indigoidine_A
  • amino acids 16 to 303 (288 residues), 419.2 bits, E=4.4e-130

Best Hits

Swiss-Prot: 88% identical to PSUG_CUPNJ: Pseudouridine-5'-phosphate glycosidase (psuG) from Cupriavidus necator (strain JMP 134 / LMG 1197)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_6279)

MetaCyc: 59% identical to pseudouridine-5'-phosphate glycosidase (Escherichia coli K-12 substr. MG1655)
Pseudouridylate synthase. [EC: 4.2.1.70]

Predicted SEED Role

"Pseudouridine 5'-phosphate glycosidase"

MetaCyc Pathways

• pseudouridine degradation (1/2 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70

Use Curated BLAST to search for 4.2.1.70

Sequence Analysis Tools

See B2TB10 at UniProt or InterPro

Protein Sequence (317 amino acids)

>BPHYT_RS31120 pseudouridine-5'-phosphate glycosidase (Burkholderia phytofirmans PsJN)
MITDPARSWLSFSAPVAAAQAAGRPLVALESTIIAHGMPYPENVRTAREVEAVIRSLGAE
PATIALIDGRIRIGLSNDELELLGRSDQVHKVSRRDLPAVLAAGGLGATTVAGTMICAAL
AGIEVFVTGGIGGVHRGAPETFDISADLQELAKTSVAVVCAGAKSILDIGLTLEYLETHG
VPVLSCEQDNFAAFYTRDSGFRADFRLDDAAQQARFIRTKWDLGLVGGVVLSTPVPEAAA
MKSEEIDALTQQALAEAAAKGIAGKAVTPFLLARIKALTSGRSLATNIALIKHNAEVGAR
LALALAHAGRGACSNGR