Protein Info for BPHYT_RS31065 in Burkholderia phytofirmans PsJN

Annotation: polysaccharide biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 47 to 67 (21 residues), see Phobius details amino acids 95 to 120 (26 residues), see Phobius details amino acids 127 to 149 (23 residues), see Phobius details amino acids 160 to 179 (20 residues), see Phobius details amino acids 185 to 205 (21 residues), see Phobius details amino acids 232 to 254 (23 residues), see Phobius details amino acids 266 to 287 (22 residues), see Phobius details amino acids 308 to 328 (21 residues), see Phobius details amino acids 345 to 366 (22 residues), see Phobius details amino acids 378 to 406 (29 residues), see Phobius details amino acids 419 to 436 (18 residues), see Phobius details PF01943: Polysacc_synt" amino acids 13 to 293 (281 residues), 45.9 bits, see alignment E=5.3e-16 PF13440: Polysacc_synt_3" amino acids 37 to 333 (297 residues), 23.3 bits, see alignment E=3.5e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_6268)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TAZ9 at UniProt or InterPro

Protein Sequence (454 amino acids)

>BPHYT_RS31065 polysaccharide biosynthesis protein (Burkholderia phytofirmans PsJN)
MTPTGLPRSPTILKRIASSFVFRLSGAVTNFSFVIFLGRYLGASQTGLYMIGLGFLSVLS
TFCRLGLEQIVIRDGGPMVRDRQWAQLRSLYRQTMLLAAAASLALTLTVILLSTPLALYV
FHKQELASVLVWFAVALLPTSIAMMHVPFLQIIGKPERSIAVFSVWVPLLSFLSLFCMPP
SSAVTAAYIFVGASTVNLAIAYIPFGRFMRSAGGLPGPIGPLWNVRLLRPALPLLIGNTC
QMALLWIAVFAVGIHSSPSDVGGYSVAQRVALTLSGFLVPPIDALVGPRLSMMRGTSSKH
DIEWIVQRVSAALLILVSGLFVVLVVSGHQLLRLFGNDFGAGYGPLLFLSAGQLAVVASG
SIRPLLVVHGLERVIRNAMVIATLACIALAAILVPTLGATGAALATALALAGEKLAEGLV
AWKVLGICVYPSLSFYRREIATLLKHHAKRTQTE