Protein Info for BPHYT_RS31015 in Burkholderia phytofirmans PsJN

Annotation: 3-deoxy-manno-octulosonate cytidylyltransferase 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 TIGR00466: 3-deoxy-D-manno-octulosonate cytidylyltransferase" amino acids 9 to 248 (240 residues), 230.1 bits, see alignment E=1.3e-72 PF02348: CTP_transf_3" amino acids 12 to 226 (215 residues), 185.9 bits, see alignment E=9.4e-59 PF12804: NTP_transf_3" amino acids 17 to 177 (161 residues), 36.8 bits, see alignment E=4.6e-13

Best Hits

Swiss-Prot: 100% identical to KDSB2_PARPJ: 3-deoxy-manno-octulosonate cytidylyltransferase 2 (kdsB2) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K00979, 3-deoxy-manno-octulosonate cytidylyltransferase (CMP-KDO synthetase) [EC: 2.7.7.38] (inferred from 100% identity to bpy:Bphyt_6258)

Predicted SEED Role

"3-deoxy-manno-octulosonate cytidylyltransferase (EC 2.7.7.38)" in subsystem KDO2-Lipid A biosynthesis (EC 2.7.7.38)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.38

Use Curated BLAST to search for 2.7.7.38

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TAY9 at UniProt or InterPro

Protein Sequence (263 amino acids)

>BPHYT_RS31015 3-deoxy-manno-octulosonate cytidylyltransferase 2 (Burkholderia phytofirmans PsJN)
MRSSSDPASIHVVIPARFGSTRLPGKPLIDLAGEPMIVRVYEAVRAALPETVNIVVATDD
ERIVGSLEAYRIPVRMTDPEHQSGTDRCAQVARELGWNSDDLVVNVQGDEPLVPQPLLAS
FVQFCANAQAFDMATVAVPLTEVSHLTDPNVVKLVVGAQGQAIVFSRSAIPFCRDLPQNE
WPLSAYLRHVGIYAYRCSALYRLTETPSCELEELERLEQMRAIWLGMPIRVFEWPEPPPP
GVDTKEDVARVREILFVNASGRS