Protein Info for BPHYT_RS31010 in Burkholderia phytofirmans PsJN

Annotation: arabinose 5-phosphate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 PF01380: SIS" amino acids 41 to 170 (130 residues), 105.1 bits, see alignment E=2.5e-34 TIGR00393: sugar isomerase, KpsF/GutQ family" amino acids 44 to 309 (266 residues), 329.3 bits, see alignment E=1e-102 PF00571: CBS" amino acids 203 to 253 (51 residues), 16.7 bits, see alignment 7.8e-07 amino acids 265 to 309 (45 residues), 25.8 bits, see alignment 1.1e-09

Best Hits

Swiss-Prot: 50% identical to API_HAEIN: Probable arabinose 5-phosphate isomerase (HI_1678) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K06041, arabinose-5-phosphate isomerase [EC: 5.3.1.13] (inferred from 100% identity to bpy:Bphyt_6257)

Predicted SEED Role

"Arabinose 5-phosphate isomerase (EC 5.3.1.13)" in subsystem KDO2-Lipid A biosynthesis (EC 5.3.1.13)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.13

Use Curated BLAST to search for 5.3.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TAY8 at UniProt or InterPro

Protein Sequence (311 amino acids)

>BPHYT_RS31010 arabinose 5-phosphate isomerase (Burkholderia phytofirmans PsJN)
MTAHDYISSAKRVFALESSAIAALASALDDDYPQAIARILETRGRVIVCGMGKSGIIGKK
IAATFASTGTPAFFMHPGEAYHGDLGMVTSDDVFLAISNSGETHEVVQLLPFLRNNHNFV
IAMTGNRESTLARAGHCHLDIGVEKEACPLQLAPTASTTATLAMGDALAVTLMEARDFKP
EGFARFHPGGSLGRRLLSTVGDEMVRDRLPFVGPDAKAMEIVSEMTRGSLGIAIVRDETG
WGLITDGDVRRLIEVHGPHAFEKCARDFMSREPTMVSPATRVQDALALLDQRRITSLLVF
EHQQIVGVFKK