Protein Info for BPHYT_RS30930 in Burkholderia phytofirmans PsJN

Annotation: PAS/PAC sensor signal transduction histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 748 TIGR00229: PAS domain S-box protein" amino acids 45 to 152 (108 residues), 68.8 bits, see alignment E=2.4e-23 amino acids 159 to 282 (124 residues), 36.7 bits, see alignment E=2e-13 amino acids 285 to 406 (122 residues), 48.8 bits, see alignment E=3.8e-17 amino acids 402 to 528 (127 residues), 49.2 bits, see alignment E=2.7e-17 PF00989: PAS" amino acids 46 to 143 (98 residues), 26 bits, see alignment E=2.8e-09 amino acids 289 to 398 (110 residues), 27.9 bits, see alignment E=7.2e-10 amino acids 407 to 518 (112 residues), 26.3 bits, see alignment E=2.2e-09 PF13426: PAS_9" amino acids 48 to 145 (98 residues), 46.3 bits, see alignment E=1.5e-15 amino acids 305 to 399 (95 residues), 29.5 bits, see alignment E=2.7e-10 PF08448: PAS_4" amino acids 168 to 276 (109 residues), 41.9 bits, see alignment E=3.8e-14 amino acids 293 to 403 (111 residues), 60.4 bits, see alignment E=6.9e-20 amino acids 413 to 521 (109 residues), 44.1 bits, see alignment E=7.5e-15 PF08447: PAS_3" amino acids 339 to 393 (55 residues), 26.7 bits, see alignment 1.9e-09 PF07730: HisKA_3" amino acids 549 to 614 (66 residues), 58.8 bits, see alignment E=2.3e-19 PF02518: HATPase_c" amino acids 655 to 745 (91 residues), 54.2 bits, see alignment E=6.6e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_6241)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TAX2 at UniProt or InterPro

Protein Sequence (748 amino acids)

>BPHYT_RS30930 PAS/PAC sensor signal transduction histidine kinase (Burkholderia phytofirmans PsJN)
MKEISGDPRKAPAAATRQDDGRLELPAAEPDTLMHLKSCALALVSDAAYLIDQNACFIYV
NEAACRSLGYSQAQLLRMRVMDVDPEWNFERWRDVWKELRENGSMMIESRQRREDGTTLP
VEISVSYFEYEGQPYNLALVRDITERKRTEQLLIAQLELEAQFRRLAESTPDIICRYDLD
CRLVYANSGLAAILRRPLHEMLGATPTEHTADPQFVAYQNALAATLETGAERTHELTLRD
GGDDVSYHHVRILAERGLHDEITSVLALGRDITERKKAEERLHASGQAFRALVEHSPDYI
ARFDRECRRIYANPALRAILPPVADEAMGTESVDESPVVDVPRYRDQLQRVVETGTERMD
EVRFRNANGEVRWGHMRMVPEFAADGQVATVLAICRDIDELKRSEQLFRTLTENAPEMIV
RYDRNCRYSYVNPRFEQVNGMRAADAIDKAPAELSDSVMPELRMITATLEQVMASGIGAK
VDLTSEKNGKPVGWHVSAVPEHGANGDIRGALTIWTDITERMEVELRLRESYALLQELTS
LRETAREEERKRIAREMHDELGQQLTALRLGVSAMRIEFAQDDPALAGRFRDLLALADDT
MQVVRNVVASLRPAAIDAGIVAALEWLAAEFSRDGRVACHLRIPDDNLVLDEARAIALFR
IVQEALTNVARHAAATQVTISLEQTGRCWVLEISDDGCGFDSMAARMKSFGLVGMRERVL
MLGGEISVCSAPGSGTSITVCIPVDDAS