Protein Info for BPHYT_RS30905 in Burkholderia phytofirmans PsJN

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 553 PF00072: Response_reg" amino acids 18 to 130 (113 residues), 88.3 bits, see alignment E=1.2e-28 TIGR00229: PAS domain S-box protein" amino acids 203 to 325 (123 residues), 48.5 bits, see alignment E=4.6e-17 PF13188: PAS_8" amino acids 207 to 251 (45 residues), 28.4 bits, see alignment 3.6e-10 PF00989: PAS" amino acids 208 to 305 (98 residues), 38.3 bits, see alignment E=3.7e-13 PF13426: PAS_9" amino acids 221 to 316 (96 residues), 31.1 bits, see alignment E=7.1e-11 PF07730: HisKA_3" amino acids 346 to 412 (67 residues), 52.1 bits, see alignment E=2.4e-17 PF02518: HATPase_c" amino acids 453 to 542 (90 residues), 40.9 bits, see alignment E=7.5e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_6236)

Predicted SEED Role

"COG0745: Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T8J5 at UniProt or InterPro

Protein Sequence (553 amino acids)

>BPHYT_RS30905 histidine kinase (Burkholderia phytofirmans PsJN)
MNEPNVEASVEAGERPTILIADDTPANFGVVVESLTDRGFRVLVALDGEEALERALFSQP
DLILLDVKMPGIDGFETCRRLKADARTRDITVIFMTSLTGAEDMVEGFSAGGVDYVAKPV
RVNEMMARIETHLALRVMHRQLIVQNRLLLKEVAVRQQAETELSSARDALEQQVEQRTRQ
LAESNTRLSAQIDERRRAEANLQASEARFRTIVETSPIPLCITSMPEGVILYVNEPLREL
FGLDTGMRTLTNIVDFYIDPADRDRLVSHLRAEGSFNNSEVHMRRVDGSPFWAIATARVA
TFGDAPAIYVGLSDITSRKRIEQELFESRNQLRELSAYMEAIREEERKRIAMEIHDELGQ
LLTALKMDVSLLKMRLGKDPDAMRKADDMRELVEKTIWMVCNVANHLRPVALNFGVVSAL
EWLVEDFIRRHGIPCQLHINGGEPVLPEACATAVFRIVQASLTNVGRHAHATRADVTLTS
TAAALDLHVSDDGCGFDPGMARTGYSYGLLGMQERARLIGGAMTIDSAQGMGTAISIHIP
LTGGAENDRRPDC