Protein Info for BPHYT_RS30860 in Burkholderia phytofirmans PsJN

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 53 to 72 (20 residues), see Phobius details amino acids 79 to 96 (18 residues), see Phobius details amino acids 102 to 124 (23 residues), see Phobius details amino acids 132 to 150 (19 residues), see Phobius details amino acids 167 to 189 (23 residues), see Phobius details amino acids 222 to 241 (20 residues), see Phobius details amino acids 253 to 271 (19 residues), see Phobius details amino acids 275 to 323 (49 residues), see Phobius details PF02653: BPD_transp_2" amino acids 53 to 313 (261 residues), 130.7 bits, see alignment E=2.8e-42

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to bpy:Bphyt_6226)

Predicted SEED Role

"Nucleoside ABC transporter, permease protein 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T8I9 at UniProt or InterPro

Protein Sequence (329 amino acids)

>BPHYT_RS30860 sugar ABC transporter permease (Burkholderia phytofirmans PsJN)
MTDAQKPAKRPRRWSGALGRSSEIRIFAVALILCVYFETVNHDFLLTGASLQNLSQFIAP
VAIIAFGEIMLMIGGEIDLSAGMVFAFAPFIMYFAIEAGLPPWLGMLAGVVAAGIVGLIN
GAVTVYLRIPSFVTTLGTLFFVNGLTLTISRGTPVSPPENSAFAAFMGGWGYSEIIWTLA
LAAFMHVLLRHTRWGLHTIASGANPLGASEAGIQVRRLKLGNFILAALLAGLTGILEGFR
ITSIDPQAGGNQIMFLAVAAAVIGGTPLAGGSGTIIGGLIGAAVLGILNDGFTLIGINAF
TFNMILGAAILGAMIFNIHVVRLARKGNL