Protein Info for BPHYT_RS30830 in Burkholderia phytofirmans PsJN

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 51 to 73 (23 residues), see Phobius details amino acids 83 to 109 (27 residues), see Phobius details amino acids 166 to 189 (24 residues), see Phobius details amino acids 224 to 246 (23 residues), see Phobius details amino acids 266 to 290 (25 residues), see Phobius details amino acids 302 to 320 (19 residues), see Phobius details amino acids 326 to 350 (25 residues), see Phobius details amino acids 362 to 383 (22 residues), see Phobius details amino acids 389 to 410 (22 residues), see Phobius details PF07690: MFS_1" amino acids 20 to 376 (357 residues), 192.4 bits, see alignment E=1.1e-60 PF00083: Sugar_tr" amino acids 38 to 187 (150 residues), 23.5 bits, see alignment E=2.5e-09

Best Hits

Swiss-Prot: 41% identical to SAUU_CUPNH: Probable sulfoacetate transporter SauU (sauU) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_6220)

Predicted SEED Role

"Probable glucarate transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T8I3 at UniProt or InterPro

Protein Sequence (437 amino acids)

>BPHYT_RS30830 MFS transporter (Burkholderia phytofirmans PsJN)
MESIRRRNRFSATTGVLIVLCIMSFLMYVDRTNISTAALAIRRDLHLSNSQLGIVFSAFA
LTYALAMIPGGFIGDRLGARKMLAVCGVLWGLGTLLTGFAGGLGTLLLARFVVGLGESPI
VPASARALTAWMEPERRGFSQGITHACARLGNASTPILVAGLITAFSWHIAFIVLGAASL
AWVVLWVWYYRDNPADHPGITPQDIARLPAKLGKTRVPMRWPPLLRALWPATVVSFCHGW
ILWFFLNWMPSFFAQAYHLNIRHSAIFSSGIFLSGVVGTTLGGSLSDLMLKKTGNIRRSR
QTLITVGFLAPIVFFVPMFLHTSPTLAALSLAAALFLSELVTAPLWAVAMDLAPNHAATS
SSIMNTGLGIAASVSPPLVGWLVDTMHSWQPVFALSMFFLVLGPIAAHWIRPDRPYLGEP
EAETKEAGGFAARMDAY