Protein Info for BPHYT_RS30805 in Burkholderia phytofirmans PsJN

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 transmembrane" amino acids 33 to 52 (20 residues), see Phobius details amino acids 60 to 82 (23 residues), see Phobius details amino acids 97 to 121 (25 residues), see Phobius details amino acids 152 to 173 (22 residues), see Phobius details amino acids 179 to 199 (21 residues), see Phobius details amino acids 232 to 252 (21 residues), see Phobius details amino acids 271 to 295 (25 residues), see Phobius details amino acids 306 to 326 (21 residues), see Phobius details amino acids 332 to 354 (23 residues), see Phobius details amino acids 367 to 392 (26 residues), see Phobius details amino acids 398 to 417 (20 residues), see Phobius details PF07690: MFS_1" amino acids 32 to 315 (284 residues), 94.3 bits, see alignment E=7.5e-31 PF00083: Sugar_tr" amino acids 57 to 208 (152 residues), 76.8 bits, see alignment E=1.6e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_6215)

Predicted SEED Role

"Major facilitator superfamily (MFS) metabolite/H+ symporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T8H8 at UniProt or InterPro

Protein Sequence (427 amino acids)

>BPHYT_RS30805 MFS transporter (Burkholderia phytofirmans PsJN)
MSSSVGVAVAAARPYRVFIATWAGWMLDGFDNAIYIYVIVPALTELLPQSGFVADHAHIA
RLGGLMFSLFMLGWACSMFWGWCADRFGRVPTMCATILIYSIFTGACGLAPGIVSFAIFR
FLTGFGIGGEWAAGAPLLQESVPEHLRERLSGWLHTGTPIGFLLASAAALVILPLGGWRV
LFLIGSAPALLTIWLRLGVPESRRWQEQRCAKGSRARVRDLFAPGMSRTTWSAALMMTCL
IFGLWSSTFWIPTLVITWQRAGGASVADAQYLGSLSGLILSVGTLAGCVTMPWIVRWIPR
RKSVATVFFSGALICNVTSYFGIVVLLKSLPLFLITLPLLGFFTSGVFSLYTIWLPEMFP
TMQRALGSGFAFSFGRVLGAAGPSIVGALAAIFGSYPLAITAVSLIYLVGLFCVKWAPET
AHRALQR