Protein Info for BPHYT_RS30800 in Burkholderia phytofirmans PsJN

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 transmembrane" amino acids 9 to 27 (19 residues), see Phobius details amino acids 45 to 66 (22 residues), see Phobius details amino acids 76 to 101 (26 residues), see Phobius details amino acids 161 to 183 (23 residues), see Phobius details amino acids 222 to 243 (22 residues), see Phobius details amino acids 260 to 284 (25 residues), see Phobius details amino acids 296 to 315 (20 residues), see Phobius details amino acids 321 to 341 (21 residues), see Phobius details amino acids 349 to 376 (28 residues), see Phobius details amino acids 383 to 404 (22 residues), see Phobius details PF07690: MFS_1" amino acids 14 to 363 (350 residues), 168.7 bits, see alignment E=1.8e-53 PF11700: ATG22" amino acids 365 to 408 (44 residues), 25.3 bits, see alignment 6.5e-10

Best Hits

Swiss-Prot: 46% identical to SAUU_CUPNH: Probable sulfoacetate transporter SauU (sauU) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_6214)

Predicted SEED Role

"Probable glucarate transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T8H7 at UniProt or InterPro

Protein Sequence (427 amino acids)

>BPHYT_RS30800 MFS transporter (Burkholderia phytofirmans PsJN)
MFSGTTGRVFMLICAMYFIEYVDRVNLSIAAPLLKSEMHLSNTQLGIALSAFGYCYAIFQ
IINGYLGDKIGPRRMLAFSGILWTLGTLATGVTGGLATLVLSRALVGLGEAGTIPNATRA
MANWVPQIKRGFAQGFTHSAARLAATVTPPLIVLMIPLLGWRGAFIALGCVSAIWVVVWA
LYFRDDPRTHPTITTAEVDALPPYAGPRHRTAVPWWPLIRRIMPVTLVFFCHAWTLWLYL
SWLPSFFVGVYGIDLKSTALFTSGVFLAGVVGDTAGGLLTDALYKRTGNLNKARRNVIIM
GFAGSLLFLSCVLFVRDRTVIALCLAAALFCLESTEGPIWAVPMDIAPAFAGVASGFIST
AAGLAAVVSPVAFGLITDMTGSYRLPFVMSIALLLVGIALSFWIRPDRPLQAGAKPTLST
ESLGVHS