Protein Info for BPHYT_RS30755 in Burkholderia phytofirmans PsJN

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 471 transmembrane" amino acids 36 to 64 (29 residues), see Phobius details amino acids 76 to 98 (23 residues), see Phobius details amino acids 106 to 127 (22 residues), see Phobius details amino acids 133 to 153 (21 residues), see Phobius details amino acids 165 to 187 (23 residues), see Phobius details amino acids 198 to 215 (18 residues), see Phobius details amino acids 286 to 308 (23 residues), see Phobius details amino acids 321 to 342 (22 residues), see Phobius details amino acids 349 to 368 (20 residues), see Phobius details amino acids 374 to 395 (22 residues), see Phobius details amino acids 408 to 429 (22 residues), see Phobius details amino acids 436 to 457 (22 residues), see Phobius details PF07690: MFS_1" amino acids 72 to 333 (262 residues), 74.3 bits, see alignment E=9.1e-25 PF00083: Sugar_tr" amino acids 80 to 470 (391 residues), 124.4 bits, see alignment E=6e-40

Best Hits

Swiss-Prot: 33% identical to YYAJ_BACSU: Putative metabolite transport protein YyaJ (yyaJ) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_6205)

Predicted SEED Role

"Major facilitator superfamily (MFS) metabolite(sugar)/H symporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T8G8 at UniProt or InterPro

Protein Sequence (471 amino acids)

>BPHYT_RS30755 MFS transporter (Burkholderia phytofirmans PsJN)
MYMEKEIAGATAVEASVSARLDRLPPTRYFSGLVARIAIGGWFEFYEMFMAAYISLGLIG
SGLYRATTAGLFDVNGFASFLGSFFAGMFVGTVALGGFTDRFGRRAVFTCAMLIYSVATF
AAAFQHSPESMDLWRFVAGLGIGVQLITVDTYISELTPHHTRGRYSAFSILVILTSVPTG
AVLSFLLVPHTILGLEGWRWVMIIGSAGAVLIWFMRRGLPESPRWLESKGRVDEARAIVD
AIEARVVAETRCPLQAPAQHAPEPPAGEQSGSWSEMWKGRYFSRTVMLSFFNFFQTFGVY
GFGAWVPVLLYTKGITITHSLLYTMVIAFATPLGALGAMACAERVQRKWQLVGCAIVVAV
AGVLFGMVREPVLILLFGSAVTIANNWLIGIFHTYQAELYPTRIRARAVGFVFSWSRLSS
IFVGFWVAALLKHSGVPAVFVLISSAMFVIVVMVGLLGPKTNGIRLEELSQ