Protein Info for BPHYT_RS30730 in Burkholderia phytofirmans PsJN

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 51 to 71 (21 residues), see Phobius details amino acids 79 to 101 (23 residues), see Phobius details amino acids 108 to 128 (21 residues), see Phobius details amino acids 137 to 159 (23 residues), see Phobius details amino acids 167 to 187 (21 residues), see Phobius details amino acids 210 to 230 (21 residues), see Phobius details amino acids 239 to 264 (26 residues), see Phobius details amino acids 276 to 297 (22 residues), see Phobius details amino acids 303 to 323 (21 residues), see Phobius details amino acids 341 to 366 (26 residues), see Phobius details amino acids 374 to 394 (21 residues), see Phobius details PF07690: MFS_1" amino acids 17 to 243 (227 residues), 118.6 bits, see alignment E=3e-38 amino acids 217 to 396 (180 residues), 35.1 bits, see alignment E=7.3e-13 PF00083: Sugar_tr" amino acids 52 to 184 (133 residues), 27.9 bits, see alignment E=1.2e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_6200)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T8G3 at UniProt or InterPro

Protein Sequence (408 amino acids)

>BPHYT_RS30730 MFS transporter (Burkholderia phytofirmans PsJN)
MKSAHVTSALPAPIYWLALGAFAIGTEGFMISPLLPGLAADLSVKIETAGQLVTVFALAY
GLSSPVLTALSGNLNRRTLLLASMIAFALSNVLAMVAPNFWALMGARVLLALSAGLYVPG
ANALASAIVPPERRGRAIAVVNGGITIAIALGVPLGAVVGHALGWRMTFAGVAGLAMLAA
AGLVVGLPRDIGAGIPVATLRERIAVGRNPVVLATLLTTTLWATGAYTVYTYLSPFLASV
TGLAGAQIGMVMFMWGLAAAAGVVTGGNASDRFGPLAVIVPTIALSGLAFAMLSISARFL
SPAAALIPVLVAIALWGVAHWAFYPAQQARLIDIAGLKVAPIVLSLNASFMYIGFSLGAA
LGALTLAHGGVGSLGWVAAASELAAVLLTLAIVGRPAVAGAACQAERG