Protein Info for BPHYT_RS30665 in Burkholderia phytofirmans PsJN

Annotation: peroxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 PF04261: Dyp_perox_N" amino acids 9 to 139 (131 residues), 112.2 bits, see alignment E=2.2e-36 TIGR01413: Dyp-type peroxidase family" amino acids 9 to 304 (296 residues), 286.2 bits, see alignment E=3.5e-89 PF20628: Dyp_perox_C" amino acids 143 to 303 (161 residues), 194.8 bits, see alignment E=9.1e-62 TIGR04537: encapsulation C-terminal sorting signal" amino acids 336 to 346 (11 residues), 13.4 bits, see alignment (E = 7.9e-06)

Best Hits

KEGG orthology group: K07223, putative iron-dependent peroxidase (inferred from 100% identity to bpy:Bphyt_6187)

Predicted SEED Role

"Predicted dye-decolorizing peroxidase (DyP), encapsulated subgroup"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T8F0 at UniProt or InterPro

Protein Sequence (351 amino acids)

>BPHYT_RS30665 peroxidase (Burkholderia phytofirmans PsJN)
MPNETPEPQAICNDVSRSAIFIVATIANDRDQEAKVREWCGDIAALVRAVGKRVPAGNLS
CVCSFGSDAWDRLFGAPRPALLHPFRDIGEGERRALGTPGDFLLHIRAEHMDLCFELATQ
LLGALGDAVTVVDEVHGFRYFDMRDMVGFVDGTENPTGRAADEYTLITEDPGFEGGSYVL
VQKYLHDMDGWNALSVETQERIIGRKKLSDVELDAAIKPSSSHSSLTTITENGKEVKILR
DNMPFGRLGAAEFGTYFIGYARSPAPIEQMLENMFIGRPPGNYDRLLDYSRAVTGGLFFV
PSATLLEELADRDPPSVTAAIETHSEPSSPAEPRHDGSLNIGSLKGISQHE