Protein Info for BPHYT_RS30565 in Burkholderia phytofirmans PsJN

Annotation: dihydropteridine reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 PF00042: Globin" amino acids 27 to 132 (106 residues), 48 bits, see alignment E=2.5e-16 PF00970: FAD_binding_6" amino acids 159 to 254 (96 residues), 46.5 bits, see alignment E=5.8e-16 PF00175: NAD_binding_1" amino acids 264 to 368 (105 residues), 60.8 bits, see alignment E=2.9e-20

Best Hits

Swiss-Prot: 78% identical to HMP_BURST: Flavohemoprotein (hmp) from Burkholderia sp. (strain TH2)

KEGG orthology group: K05916, nitric oxide dioxygenase [EC: 1.14.12.17] (inferred from 100% identity to bpy:Bphyt_6164)

Predicted SEED Role

"Flavohemoprotein (Hemoglobin-like protein) (Flavohemoglobin) (Nitric oxide dioxygenase) (EC 1.14.12.17)" in subsystem Bacterial hemoglobins or Flavohaemoglobin or Glutaredoxins (EC 1.14.12.17)

Isozymes

Compare fitness of predicted isozymes for: 1.14.12.17

Use Curated BLAST to search for 1.14.12.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T8C8 at UniProt or InterPro

Protein Sequence (393 amino acids)

>BPHYT_RS30565 dihydropteridine reductase (Burkholderia phytofirmans PsJN)
MLSAEHRAIVKATVPLLESGGEALTTHFYDMLISEHPEVRPMFNLANQASGAQQRALANG
VLMYARHIDQLEQLGGLVSQIINKHVALNILPEHYPIVGQCLLRSIREVLGAEIATDAVI
EAWAAAYQQLADLLSGLEEKMYAEREAAPGGWRGTRLFRVARKVRESDEITSFYLRPADN
GELLAFHPGQYIGVRLVIDGEEVRRNYSLSAMSNGEEYRISVKREANGKVSNHLHARVNE
NDTVELFAPAGDFKLEDSDKPLVLISGGVGITPTLAMLQAALKTDRPVHFIHSARHGGVH
AFRDVIDQLAARHPKLKRFYCYEQRRAEDADAHGIGYLDEKRLDAWLPRTRDVDVYFLGP
IAFMKAIKKHLKAIGVPESQSRYEFFGPASALE