Protein Info for BPHYT_RS30560 in Burkholderia phytofirmans PsJN

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 531 PF13185: GAF_2" amino acids 38 to 174 (137 residues), 32 bits, see alignment E=5.5e-11 PF01590: GAF" amino acids 40 to 174 (135 residues), 42.5 bits, see alignment E=3.8e-14 PF00158: Sigma54_activat" amino acids 209 to 375 (167 residues), 232.5 bits, see alignment E=9.6e-73 PF14532: Sigma54_activ_2" amino acids 210 to 380 (171 residues), 77.1 bits, see alignment E=6.7e-25 PF07728: AAA_5" amino acids 233 to 351 (119 residues), 31.1 bits, see alignment E=9e-11 PF00004: AAA" amino acids 233 to 366 (134 residues), 24.6 bits, see alignment E=1.2e-08 PF02954: HTH_8" amino acids 488 to 522 (35 residues), 22.3 bits, see alignment 3.5e-08

Best Hits

KEGG orthology group: K12266, anaerobic nitric oxide reductase transcription regulator (inferred from 100% identity to bpy:Bphyt_6163)

Predicted SEED Role

"Functional role page for Anaerobic nitric oxide reductase transcription regulator NorR" in subsystem Nitrosative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T8C7 at UniProt or InterPro

Protein Sequence (531 amino acids)

>BPHYT_RS30560 transcriptional regulator (Burkholderia phytofirmans PsJN)
MVNSTLVEKTPDGVNLTAEALLDALTPLIRDLSRDLPESERYRRLLSSLRALFPGDAAAL
LRLEGDTLVPLAIDGLSSDTLGRRFRVGDHPRFEQLLSRPEPTRFAADSDLPDPYDGLVQ
GVAGHLEVHDCLGCPLFVRGRPWGLLTLDALDPARFDSIDMASLRAFLGLAAATVSVVER
IDTLARSTEEERARAEAYRQASSQSRREMVGSSDAHTHLMKEIEVVAGSDLTVLITGETG
VGKELVANAIHALSSRANKPLISLNCAALPDTLVESELFGHVRGAFSGASSDRRGKFELA
DGGTIFLDEVGELPLLVQAKLLRVLQNGQLQRIGSDHEHKVDVRLIAATNRDLAEEVRAG
RFRADFYHRLSVYPLRVPPLRERGRDVLLLAGFFLEENRSRLGLLSLRLAADAQAMLLRY
PWPGNVRELEHLIGRSALKALATNRERRRILTLTAADFALAAAPEEDRAQNTQAETTETA
SKDFRSAVTEFERNMVVDALARHNQNWAAVARELGLDRANLNRLAKRLGLK