Protein Info for BPHYT_RS30410 in Burkholderia phytofirmans PsJN

Annotation: chloroperoxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 PF00561: Abhydrolase_1" amino acids 21 to 256 (236 residues), 124.8 bits, see alignment E=1.5e-39 PF12697: Abhydrolase_6" amino acids 23 to 263 (241 residues), 82.6 bits, see alignment E=2e-26 PF12146: Hydrolase_4" amino acids 23 to 256 (234 residues), 92.8 bits, see alignment E=6.5e-30 PF20434: BD-FAE" amino acids 41 to 239 (199 residues), 28.8 bits, see alignment E=2.6e-10 PF00326: Peptidase_S9" amino acids 190 to 272 (83 residues), 32.2 bits, see alignment E=2.4e-11 PF01738: DLH" amino acids 207 to 265 (59 residues), 23.1 bits, see alignment E=1.4e-08

Best Hits

Swiss-Prot: 68% identical to THCF_RHOER: Non-heme haloperoxidase (thcF) from Rhodococcus erythropolis

KEGG orthology group: K00433, chloride peroxidase [EC: 1.11.1.10] (inferred from 100% identity to bpy:Bphyt_6134)

Predicted SEED Role

"Non-heme chloroperoxidase (EC 1.11.1.10)" (EC 1.11.1.10)

Isozymes

Compare fitness of predicted isozymes for: 1.11.1.10

Use Curated BLAST to search for 1.11.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TAW7 at UniProt or InterPro

Protein Sequence (273 amino acids)

>BPHYT_RS30410 chloroperoxidase (Burkholderia phytofirmans PsJN)
MNTVTTKDGTRIFFKDWGSGKPVVFSHGWPLDADAWDAQMLFLVQKGYRVIAHDRRGHGR
SDQPSHGNDMDTYADDLAAVINALDLKGATLVGHSTGGGEVAHYIGRHGTARVAKAVLIG
AVPPLMLKTEGNPNGLPMSVFDGIRASVASNRSQFYKDLAVPFYGFNRPNAKVSQGTIDE
FWREGMLGSIQGQYECVKQFSEVDYTADLKKIDVPTLILHGDDDQIVPIDDSARLSAKLV
KNATLKVYPGAPHGMCTTEADKVNADLLAFLQS