Protein Info for BPHYT_RS30345 in Burkholderia phytofirmans PsJN
Annotation: alanyl-tRNA synthetase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K01872, alanyl-tRNA synthetase [EC: 6.1.1.7] K07050, (no description) (inferred from 100% identity to bpy:Bphyt_6121)Predicted SEED Role
"Ser-tRNA(Ala) deacylase; Gly-tRNA(Ala) deacylase"
MetaCyc Pathways
- tRNA charging (20/21 steps found)
- superpathway of chorismate metabolism (42/59 steps found)
- shinorine biosynthesis (3/8 steps found)
- vanchrobactin biosynthesis (2/8 steps found)
- enterobactin biosynthesis (4/11 steps found)
- ergotamine biosynthesis (4/12 steps found)
- (2S,3E)-2-amino-4-methoxy-but-3-enoate biosynthesis (2/10 steps found)
- bacillibactin biosynthesis (3/12 steps found)
- superpathway of ergotamine biosynthesis (5/18 steps found)
- sulfazecin biosynthesis (1/16 steps found)
- phosalacine biosynthesis (6/25 steps found)
- phosphinothricin tripeptide biosynthesis (6/25 steps found)
- corallopyronin A biosynthesis (2/30 steps found)
- colibactin biosynthesis (6/38 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 6.1.1.7
Use Curated BLAST to search for 6.1.1.7
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See B2TAV0 at UniProt or InterPro
Protein Sequence (237 amino acids)
>BPHYT_RS30345 alanyl-tRNA synthetase (Burkholderia phytofirmans PsJN) MPHYLCHEQPDLLDFETAVIAARPGAVVLGRSALHPGGGGQVSDAATLTHAQGAVRITGV AAEGDVLWHLLDAPLELDGNVHVAIDAARRAAVAQLHTVTHILNALVYQRFAGALVTGAQ INADGTARMDFDLPEADNDALRLLEEPVNEVIRSAMEVRTYYVGTDEAKATQGLIRSLSV APPPTPDGTVRIVEIGDLDRQACGGTHLTNTAQSRPIRIAKIENKGRRNRRVRIELV