Protein Info for BPHYT_RS30290 in Burkholderia phytofirmans PsJN

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 transmembrane" amino acids 37 to 55 (19 residues), see Phobius details amino acids 64 to 86 (23 residues), see Phobius details amino acids 98 to 117 (20 residues), see Phobius details amino acids 124 to 146 (23 residues), see Phobius details amino acids 164 to 185 (22 residues), see Phobius details amino acids 197 to 216 (20 residues), see Phobius details amino acids 256 to 278 (23 residues), see Phobius details amino acids 285 to 304 (20 residues), see Phobius details amino acids 316 to 333 (18 residues), see Phobius details amino acids 339 to 360 (22 residues), see Phobius details amino acids 385 to 405 (21 residues), see Phobius details amino acids 411 to 430 (20 residues), see Phobius details PF00083: Sugar_tr" amino acids 25 to 238 (214 residues), 88.3 bits, see alignment E=5.4e-29 PF07690: MFS_1" amino acids 31 to 395 (365 residues), 96.7 bits, see alignment E=1.4e-31 amino acids 291 to 444 (154 residues), 42.2 bits, see alignment E=5.2e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_6110)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TAT9 at UniProt or InterPro

Protein Sequence (452 amino acids)

>BPHYT_RS30290 MFS transporter (Burkholderia phytofirmans PsJN)
MNSDATAALTSLTATRPTSKVRRAVTTAVLGQVLEWYDFFLYGTAAALVFGKLFFPVGSD
PLTGTIAAFGGFTVGFIARPIGGVLCGHIGDRYGRKTVMMLTLLVMGTATVCMGLLPTYQ
QVGIAAPIMLVLLRVLQGLAAGGEWSGSILLIHESAPASRRGALAAWSPCGAAFGFVLST
AAFLLVQTLSPADFHSWGWRVPFLCSAALVALGLWMRRSVDESAEFAAVKATHRDARMPV
VEVLRQCPRQVLTVFGLRFGEGAASYIFFAFSIAYGQFIGLKSSWVLGGLTVSMLLMIPV
SLLMGRLTDRVGRKPVYLAGAVAMVLVAYPYFTLLGSGVLWKVITALVLANSITLGILEG
AQPAFISELLPVHLRFSGLGIGREISSVLGGGLSPMVATALLAHYRSAAPVAIYLVVLGL
ITVIATCLAPETFPKALRLQAKAKEHAGHESV