Protein Info for BPHYT_RS30265 in Burkholderia phytofirmans PsJN

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02449: Glyco_hydro_42
  • amino acids 2 to 110 (109 residues), 57.9 bits, E=6e-20

Predicted SEED Role

"Beta-galactosidase (EC 3.2.1.23)" in subsystem Galactosylceramide and Sulfatide metabolism or Lactose and Galactose Uptake and Utilization or Lactose utilization (EC 3.2.1.23)

MetaCyc Pathways

• lactose degradation III (1/1 steps found)
• xyloglucan degradation II (exoglucanase) (3/8 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Glycosaminoglycan degradation
• Glycosphingolipid biosynthesis - ganglio series
• Other glycan degradation
• Sphingolipid metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.23

Use Curated BLAST to search for 3.2.1.23

Protein Sequence (122 amino acids)

>BPHYT_RS30265 hypothetical protein (Burkholderia phytofirmans PsJN)
MSDEVASFHREQIDVLREHAPSADLLHNFMGFFTTFDHYRFARDNALDVAVWESCPIART
ESMALLDEQKVRYARTAHPDVSAFDHDHYRAIGGGRFWVMGQQAGPVNWCRGIRCRRKAW
FG