Protein Info for BPHYT_RS30210 in Burkholderia phytofirmans PsJN

Annotation: GCN5 family acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 PF00583: Acetyltransf_1" amino acids 32 to 116 (85 residues), 45.5 bits, see alignment E=1.7e-15 PF13673: Acetyltransf_10" amino acids 44 to 132 (89 residues), 40.9 bits, see alignment E=4e-14 PF13508: Acetyltransf_7" amino acids 44 to 116 (73 residues), 50.8 bits, see alignment E=3.7e-17 PF18014: Acetyltransf_18" amino acids 155 to 266 (112 residues), 65 bits, see alignment E=1.1e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_6093)

Predicted SEED Role

"Histone acetyltransferase HPA2 and related acetyltransferases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TAS5 at UniProt or InterPro

Protein Sequence (290 amino acids)

>BPHYT_RS30210 GCN5 family acetyltransferase (Burkholderia phytofirmans PsJN)
MTDSITYRRFTLDDIAAAHALTAEVKWPHRTDDWRFVVQLGVGFVAEDASGVIGTALCWK
YGAERASLGMVIVSPAQQGRGIGRKLMELVLEEVGDRVTFLHATPAGQPLYEKLGFCAAG
TLDQHQGAAFQPPLVSLPPGERLRPLGSSDTARLVELASRASGLDRAEVLPALLGTADGI
ALDRDGELIGFALFRRFGRGFAIGPVVAPASEDSARAKALISHWLALNEGVFVRIDTPGE
SGLTDWLEQLGLPRVDTVIKMVRPATPGELANGAQDAQYLQYGIINQAIL