Protein Info for BPHYT_RS30090 in Burkholderia phytofirmans PsJN

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 527 PF13432: TPR_16" amino acids 18 to 80 (63 residues), 26.2 bits, see alignment E=4.9e-09 amino acids 124 to 167 (44 residues), 22.2 bits, see alignment 9e-08 amino acids 160 to 205 (46 residues), 18.9 bits, see alignment 9.4e-07 PF14559: TPR_19" amino acids 25 to 83 (59 residues), 35.3 bits, see alignment 6.4e-12 amino acids 162 to 201 (40 residues), 25.2 bits, see alignment 9.1e-09 PF13181: TPR_8" amino acids 149 to 180 (32 residues), 13 bits, see alignment (E = 5.4e-05) PF01075: Glyco_transf_9" amino acids 430 to 463 (34 residues), 28.6 bits, see alignment (E = 5e-10)

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_6068)

Predicted SEED Role

"FOG: TPR repeat"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TAQ0 at UniProt or InterPro

Protein Sequence (527 amino acids)

>BPHYT_RS30090 hypothetical protein (Burkholderia phytofirmans PsJN)
MPTDSALPFEKTLNAWFNQAEEARLAGEFDTARTLLDRIIGQDPAHADALYTYGLVALAS
NQLESAQSWVERALEVRSDPAYYGTLCIVQIKLRDYARALQTAECGLALEPASLPLNFFM
AVILQVQGRSDDAAVAYHRLLELRPDHPQALVNLGVVVKDLGSLSEAERHLRQAIALAPS
YLGARASLSQVLLAAGRYEEAWPYFEDRWANFVDADGRPASVRPTLPLPQWKGERLDIAS
ASQGMPEYGARLLVIPEQGHGDSLQFVRYLPMALERFARVGYICPPSLRRLYEESFAHLP
GLMMLDDGLSDLSDWDWHCPLMSLPMAFGTRLDNIPAATYLHADAARSASWRARLAMLPD
AGLPRVGLVWAGGHSGLTEDRARSLNPAQVAPLLALPNVRWISLQKTDDPAKRADAVTHA
PLTDWMDDATDFADTAALIDNLDLVISVDTSVAHLAAAMGKPVWLLNRFAGCWRWLRDRD
DSPWYPSVRLFTQLQRGDWDGVLERVAEALLHATGATYRKSYRSFVR