Protein Info for BPHYT_RS30060 in Burkholderia phytofirmans PsJN

Annotation: phosphoesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 transmembrane" amino acids 31 to 48 (18 residues), see Phobius details amino acids 60 to 81 (22 residues), see Phobius details amino acids 120 to 149 (30 residues), see Phobius details amino acids 157 to 177 (21 residues), see Phobius details amino acids 197 to 215 (19 residues), see Phobius details PF14378: PAP2_3" amino acids 34 to 175 (142 residues), 38.1 bits, see alignment E=1.4e-13 PF01569: PAP2" amino acids 61 to 179 (119 residues), 46.5 bits, see alignment E=3.1e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_6062)

Predicted SEED Role

"Membrane-associated phospholipid phosphatase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TAP4 at UniProt or InterPro

Protein Sequence (230 amino acids)

>BPHYT_RS30060 phosphoesterase (Burkholderia phytofirmans PsJN)
MNSFDLAIETYLSNVHLGYFATRSIERITDLYTFKGLVLIPVLWWMWFQQDERSEWRREM
VLATLLSGLVALFVGRLLTHWLPFRVRPIYSAELHLRFAGNNIKDALLTNWSSFPSDHAM
LWMAVATGIFLVWRSIGVLAILYTVLVICVPRAYLGFHYPTDLLVGAAVGIGITYVMTRE
AIRVRYARPALRWIDRYPGPSGMLAFLLCLELVTQFDELRTLASSVFKNL