Protein Info for BPHYT_RS30025 in Burkholderia phytofirmans PsJN

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 transmembrane" amino acids 37 to 59 (23 residues), see Phobius details amino acids 67 to 86 (20 residues), see Phobius details amino acids 93 to 120 (28 residues), see Phobius details amino acids 132 to 150 (19 residues), see Phobius details amino acids 156 to 175 (20 residues), see Phobius details amino acids 214 to 234 (21 residues), see Phobius details amino acids 246 to 268 (23 residues), see Phobius details amino acids 280 to 298 (19 residues), see Phobius details amino acids 304 to 326 (23 residues), see Phobius details amino acids 338 to 361 (24 residues), see Phobius details amino acids 367 to 388 (22 residues), see Phobius details PF07690: MFS_1" amino acids 8 to 286 (279 residues), 99 bits, see alignment E=4.1e-32 amino acids 216 to 391 (176 residues), 39.8 bits, see alignment E=4.2e-14 PF12832: MFS_1_like" amino acids 9 to 369 (361 residues), 47 bits, see alignment E=2.9e-16 PF01306: LacY_symp" amino acids 20 to 388 (369 residues), 29.4 bits, see alignment E=5.6e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_6055)

Predicted SEED Role

"MFS transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TAN7 at UniProt or InterPro

Protein Sequence (392 amino acids)

>BPHYT_RS30025 MFS transporter (Burkholderia phytofirmans PsJN)
MRGLDGLNFLMADVRDGLGPFLSVYLKGTQHWGSGNIGLVMAASGVAAAICQIPAGLLVD
AVRVKRLLIAISGLLVGAGCLLIAFFPKLPTVLAAQITLGAASAIIPPCLAALSLGVVGH
RLLPARISRNEGFNHAGNFTAAVLAGALGQYVGVIWLFYLICGFAVASALVVLLIKPKEI
DHELARGAEKPSETKGHTSPMPFSALWKKRDLKVFIISVVLFHFGNAAMLPLAGQVIAKV
HPGMDVIALSACVIAAQLVMVAVAAAVGHALYKGVGRKKIFLVALAVLPVRGVLFSMTSS
PYAVVAIQLLDGVAAGIFGVIGVVIASDLMRGTGRFNLAQGLMALAVGIGAALSNVTGGY
VVEKFGFTAGFLTLAAISALALAFFAAFMPET