Protein Info for BPHYT_RS30020 in Burkholderia phytofirmans PsJN

Annotation: arsenic transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 31 to 50 (20 residues), see Phobius details amino acids 60 to 77 (18 residues), see Phobius details amino acids 102 to 132 (31 residues), see Phobius details amino acids 143 to 162 (20 residues), see Phobius details amino acids 180 to 199 (20 residues), see Phobius details amino acids 222 to 242 (21 residues), see Phobius details amino acids 248 to 266 (19 residues), see Phobius details amino acids 278 to 296 (19 residues), see Phobius details amino acids 316 to 335 (20 residues), see Phobius details amino acids 342 to 363 (22 residues), see Phobius details amino acids 368 to 386 (19 residues), see Phobius details amino acids 398 to 421 (24 residues), see Phobius details PF02040: ArsB" amino acids 18 to 414 (397 residues), 109.1 bits, see alignment E=5.4e-35 PF03600: CitMHS" amino acids 23 to 363 (341 residues), 136.3 bits, see alignment E=2.1e-43 PF00939: Na_sulph_symp" amino acids 29 to 181 (153 residues), 34.5 bits, see alignment E=1.9e-12

Best Hits

KEGG orthology group: K03893, arsenical pump membrane protein (inferred from 100% identity to bpy:Bphyt_6054)

Predicted SEED Role

"Arsenic efflux pump protein" in subsystem Arsenic resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TAN6 at UniProt or InterPro

Protein Sequence (423 amino acids)

>BPHYT_RS30020 arsenic transporter (Burkholderia phytofirmans PsJN)
MNALLSSPVSVWAIAALSTLGVITRPFRLPEAVWAVLGALALCGLGMLSWSDALAAVGKG
LDVYLFLTGMMVASELARKEGLFDYLAALAAKRAAGSAKKLFFLMYCVGTIVTVFMSNDA
TAVVLTPAVLAVAHVVKAEKPLPYLYICAFIANAASFVLPISNPANLVIFQDRMPTLLSW
LGRFAVPSVLSIVATYLALRFMQRQELTQQIESEVEVPRLSAAGKATGLGIAVMAIVMLG
ASALDVSLGLPTFCAGLVLFLAICILKRKFLGAHLGEISWAVLPLVAGLFVLVEGLQRTG
VIANLAAVVRTASTTIPTHAGWISGAVMAVACNLINNLPAGLIAGSALTAAHAPTPVASA
VLIGVDLGPNFSVTGSLATILWLTALRRDGIEVTAWSFLKLGVVVTLPALVTALGAVALG
ATW