Protein Info for BPHYT_RS30010 in Burkholderia phytofirmans PsJN

Annotation: cell division protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 634 transmembrane" amino acids 16 to 36 (21 residues), see Phobius details amino acids 153 to 170 (18 residues), see Phobius details PF00004: AAA" amino acids 226 to 358 (133 residues), 133.2 bits, see alignment E=1.2e-42 PF17862: AAA_lid_3" amino acids 382 to 426 (45 residues), 27.5 bits, see alignment 2.7e-10 PF01434: Peptidase_M41" amino acids 442 to 616 (175 residues), 109.4 bits, see alignment E=3.2e-35

Best Hits

KEGG orthology group: K03798, cell division protease FtsH [EC: 3.4.24.-] (inferred from 100% identity to bpy:Bphyt_6052)

Predicted SEED Role

"Cell division protein FtsH (EC 3.4.24.-)" in subsystem Bacterial Cell Division (EC 3.4.24.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TAN4 at UniProt or InterPro

Protein Sequence (634 amino acids)

>BPHYT_RS30010 cell division protein (Burkholderia phytofirmans PsJN)
MKPGNNSLGKRRTRKIAISVAAALIAVLLAFGVWHYQQRAAQVAPALTGVASQMRHDSSA
WTHEEKDASQMLRDIHDAKVAAIGVSPNAILISKRDGTKYFVTDHNATFSHALLLGEPKA
DEAAAYQLVWLPDADIQTGGSRWVQVFDQVRDAISVLLPLLLVGGMVWFMRREMRGGATL
LARAPALRFDDVIGAGEAKTALADIRGYLSDPKQFTSMGVRAPCGILMVGGPGVGKTRLA
QALAGECGANFISITGSYFSAKYYGVGIQKVKHLFELARKNAPTVIFIDEADGLAKRTDT
GSGPVEAESNRIINQLLAEMDGFASNEGVIIVAATNHPDNLDEALRRPGRFDRTVQVRLP
DREDRAKIFRFYAEKLKSKAADIDYDQLARLTTGLSPATVAMVVNQAGLVARKSGDTEIT
SKHFMEAIKIARIGDVSGAERALSEDERTRIAVHEAGHGLVAALLGTGVLEEVTILPRGG
ALGVALITKAQDKHLYRETEIRNEIQVLLGGRNAEILTFSEASSGAASDLQEASRISLDM
VSKFGFNSDGDLFSLAALPSQYAGLQMKSAIEHANVLLKELNELCYGLLHAYEPVLRAIA
DELLEQETVPGETVYRLIKEHKSALKIVHEPEAA