Protein Info for BPHYT_RS30000 in Burkholderia phytofirmans PsJN

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 transmembrane" amino acids 20 to 49 (30 residues), see Phobius details amino acids 61 to 78 (18 residues), see Phobius details amino acids 90 to 111 (22 residues), see Phobius details amino acids 118 to 137 (20 residues), see Phobius details amino acids 149 to 175 (27 residues), see Phobius details amino acids 187 to 207 (21 residues), see Phobius details amino acids 213 to 230 (18 residues), see Phobius details amino acids 242 to 259 (18 residues), see Phobius details PF01925: TauE" amino acids 27 to 257 (231 residues), 63.3 bits, see alignment E=1.4e-21

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 100% identity to bpy:Bphyt_6050)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TAN2 at UniProt or InterPro

Protein Sequence (264 amino acids)

>BPHYT_RS30000 hypothetical protein (Burkholderia phytofirmans PsJN)
MSHFTFAGGVLGAGLQALNLYALLGIVAALLLGGMVKGVVSIGVPLVAMPILSHFLPIKE
AVLLLSMPIILGNIPQALEGGELLPTVRRIAAPLIGTVIGNIVGVTVLISLAPHRAQAAA
GALLMIAALLLLASPRLTLSPTWAKPAGFVLGFGAALMESIASVPGPLLAMYLIATGATG
KAFTKQIAIILVVSIITLVATFSGGAHASWTDLAISACASVPVIAGMLLVRPLRDRLPPS
AFRILVLVFVVAAAAQMIWKSGVL