Protein Info for BPHYT_RS29995 in Burkholderia phytofirmans PsJN

Annotation: acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 35 to 55 (21 residues), see Phobius details amino acids 81 to 101 (21 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details amino acids 162 to 182 (21 residues), see Phobius details amino acids 193 to 211 (19 residues), see Phobius details amino acids 222 to 243 (22 residues), see Phobius details amino acids 249 to 271 (23 residues), see Phobius details amino acids 278 to 300 (23 residues), see Phobius details amino acids 323 to 348 (26 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 6 to 340 (335 residues), 86.5 bits, see alignment E=9.1e-29

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_6049)

Predicted SEED Role

"O-antigen acetylase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TAN1 at UniProt or InterPro

Protein Sequence (398 amino acids)

>BPHYT_RS29995 acyltransferase (Burkholderia phytofirmans PsJN)
MNHRIAGFDGLRAIAVLMVFFQHRLFGDIGEIGHLGVWIFFALSGFLIIGILAAQRARIE
SGASRFGAELKRFLFRRTLRIFPIYYLMLVVMCVLMAFGMASPELASGMPFHFAYLSNIW
IGSVLHYWPGRYSHLWSLAIEEQFYLLFAPLLLLLAARRHRAVCLAIIAAGLVSLLAMRA
AHWQEITIYTHPLTNFWLLALGGIGGLMIAGQASRLRGWLGHGATLFALSLALVGFCATE
PMWSEVDSALLFTLVNASYGVCIAALVCSIACCRNAVVIGLLETGWLVSFGRISYGFYLY
HNLIPDLTRNHHAAALFGGTVPVWAHVVGIAGSFVISLGMAMLSWRLIEEPILRLKTRPA
PAAATTPTHAYTSTPTPPSRREQAEHSSRNESAASDAV