Protein Info for BPHYT_RS29990 in Burkholderia phytofirmans PsJN

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 transmembrane" amino acids 22 to 45 (24 residues), see Phobius details amino acids 57 to 75 (19 residues), see Phobius details amino acids 96 to 116 (21 residues), see Phobius details amino acids 148 to 169 (22 residues), see Phobius details amino acids 177 to 197 (21 residues), see Phobius details amino acids 203 to 225 (23 residues), see Phobius details amino acids 237 to 257 (21 residues), see Phobius details amino acids 275 to 297 (23 residues), see Phobius details amino acids 306 to 325 (20 residues), see Phobius details amino acids 336 to 356 (21 residues), see Phobius details PF10129: OpgC_C" amino acids 16 to 363 (348 residues), 324.4 bits, see alignment E=4.4e-101

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_6048)

Predicted SEED Role

"OpgC protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2TAN0 at UniProt or InterPro

Protein Sequence (377 amino acids)

>BPHYT_RS29990 hypothetical protein (Burkholderia phytofirmans PsJN)
METLRGRPGGSPPGGRSIEVDFFRGVVLIVIVLDHIPGSALSHLMLHAYALCDSAEVFVF
LGGYASAAAYTAVLAGRGETAAKMRFVRRCWEIYRAYLLTAILTLLSGAILATLNLNRPM
VDLTGWPPFAVQPLREAFDIMLLRRQPYLSSVLPMYVIFALSVPFAVPLARRSSLTAVSL
SLLIWALARPLAALFSIDDVADWAFNPFAWQLMFVLGIVCRVQPISERFHATRTARWFTR
VAVVAVLAFAVVKLFVLTQPLPGAFKQNLSPDRVINFIVIAWLAAQFVRMGSIAWLARRL
PAVVTVGRTGLVCFVAGTLVSLIVDTATPHMFHGFRGVLIGLGGDLVAIGAVLMIARGWN
GWKGQKSAAVANGAGYG