Protein Info for BPHYT_RS29885 in Burkholderia phytofirmans PsJN

Annotation: spermidine/putrescine ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 55 to 75 (21 residues), see Phobius details amino acids 85 to 104 (20 residues), see Phobius details amino acids 110 to 130 (21 residues), see Phobius details amino acids 142 to 163 (22 residues), see Phobius details amino acids 175 to 193 (19 residues), see Phobius details amino acids 225 to 247 (23 residues), see Phobius details amino acids 259 to 280 (22 residues), see Phobius details amino acids 301 to 319 (19 residues), see Phobius details amino acids 325 to 348 (24 residues), see Phobius details amino acids 360 to 381 (22 residues), see Phobius details amino acids 388 to 409 (22 residues), see Phobius details TIGR04259: oxalate/formate antiporter" amino acids 17 to 421 (405 residues), 628 bits, see alignment E=3.3e-193 PF07690: MFS_1" amino acids 27 to 376 (350 residues), 116.6 bits, see alignment E=6e-38 amino acids 261 to 418 (158 residues), 43.4 bits, see alignment E=1.1e-15

Best Hits

KEGG orthology group: K08177, MFS transporter, OFA family, oxalate/formate antiporter (inferred from 100% identity to bpy:Bphyt_6027)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T891 at UniProt or InterPro

Protein Sequence (447 amino acids)

>BPHYT_RS29885 spermidine/putrescine ABC transporter substrate-binding protein (Burkholderia phytofirmans PsJN)
MDDISQQTTSRAFWGNRWWQLVIGMVCMALVANLQYAWTLFVTPMNARHHWGEASIQLAF
AIFILTETWLVPLEGWLVDKFGPRPVVAGGAICAGIAWVMNSYITTLPMLYVSAVIAGIG
AGGVYGTCVGNALKWFPDKRGLAAGLTAAGFGAGAAVTVIPIANMITRSGYEHTFFFFGI
LQGGCILALALLLKKPNLRSQAAPKKKFAVSKVDFTPGQMIKTPVFWVIYVSFVAVAAGG
LMATAQIGPIAKDWGLARIPMTIFGMTLPLLTATLSIDNVCNGFTRPLCGFISDKLGREN
TMFVIFIGEGLALLGLMQYGTNPYAFMTFAALIFLFWGEIFSIFPAICADTFGSKYAAAN
AGTLYTAKGTASLLVPIASVLSATGGWNLVFIVSAVVTIAAGVAAKFVLAPMRSRWIETH
NEPQGVLAVAGTGKASRLSHWPEQTGE